Anti ADAD2 pAb (ATL-HPA079443 w/enhanced validation)
Atlas
- Catalog No.:
- ATL-HPA079443-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ADAD2
Alternative Gene Name: FLJ00337, TENRL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024266: 70%, ENSRNOG00000015690: 66%
Entrez Gene ID: 161931
Uniprot ID: Q8NCV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CFPFSVSAELDGVVCPAGTANSKTEAKQQAALSALCYIRSQLENPESPQTSSRPPLAPLSVENILTHEQRCAALVSAGFDLLLDERSPYWACKGTVAGVILE |
Gene ID - Mouse | ENSMUSG00000024266 |
Gene ID - Rat | ENSMUSG00000024266 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |