Anti CPNE4 pAb (ATL-HPA078300 w/enhanced validation)

Atlas

Catalog No.:
ATL-HPA078300-25
Shipping:
Calculated at Checkout
$303.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Adding to cart… The item has been added
Protein Description: copine 4
Gene Name: CPNE4
Alternative Gene Name: COPN4, CPN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032564: 97%, ENSRNOG00000026577: 97%
Entrez Gene ID: 131034
Uniprot ID: Q96A23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP
Gene ID - Mouse ENSMUSG00000032564
Gene ID - Rat ENSMUSG00000032564
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.