Anti KCNJ10 pAb (ATL-HPA078302 w/enhanced validation)

Atlas

Catalog No.:
ATL-HPA078302-25
Immunohistochemistry analysis in human cerebral cortex and placenta tissues using Anti-KCNJ10 antibody. Corresponding KCNJ10 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: potassium voltage-gated channel subfamily J member 10
Gene Name: KCNJ10
Alternative Gene Name: Kir1.2, Kir4.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044708: 100%, ENSRNOG00000007705: 97%
Entrez Gene ID: 3766
Uniprot ID: P78508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Gene ID - Mouse ENSMUSG00000044708
Gene ID - Rat ENSMUSG00000044708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
!