Anti LRRD1 pAb (ATL-HPA079440 w/enhanced validation)

Atlas

Catalog No.:
ATL-HPA079440-25
Immunohistochemistry analysis in human testis and rectum tissues using Anti-LRRD1 antibody. Corresponding LRRD1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeats and death domain containing 1
Gene Name: LRRD1
Alternative Gene Name: IMAGE:4798971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040367: 70%, ENSRNOG00000026196: 75%
Entrez Gene ID: 401387
Uniprot ID: A4D1F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence NLTALPSAIYNIFSLKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDGRLK
Gene ID - Mouse ENSMUSG00000040367
Gene ID - Rat ENSMUSG00000040367
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
!