Anti MLF1 pAb (ATL-HPA079339 w/enhanced validation)
Atlas
- Catalog No.:
- ATL-HPA079339-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MLF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048416: 75%, ENSRNOG00000012827: 68%
Entrez Gene ID: 4291
Uniprot ID: P58340
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNK |
| Gene ID - Mouse | ENSMUSG00000048416 |
| Gene ID - Rat | ENSMUSG00000048416 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |