Anti RASEF pAb (ATL-HPA078596)

Atlas

Catalog No.:
ATL-HPA078596-25
Immunohistochemical staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAS and EF-hand domain containing
Gene Name: RASEF
Alternative Gene Name: FLJ31614, RAB45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043003: 75%, ENSRNOG00000024190: 71%
Entrez Gene ID: 158158
Uniprot ID: Q8IZ41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISAL
Gene ID - Mouse ENSMUSG00000043003
Gene ID - Rat ENSMUSG00000043003
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
!