Anti SHMT1 pAb (ATL-HPA078682 w/enhanced validation)
Atlas
- Catalog No.:
- ATL-HPA078682-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: SHMT1
Alternative Gene Name: CSHMT, MGC15229, MGC24556, SHMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020534: 73%, ENSRNOG00000005275: 75%
Entrez Gene ID: 6470
Uniprot ID: P34896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF |
Gene ID - Mouse | ENSMUSG00000020534 |
Gene ID - Rat | ENSMUSG00000020534 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |